ELFP4 z4 ($!444<<<(?% 81=+H5LM6AEG@#$9 FD7;B/  )'&,.*2-"!3C:4.+|'ig}<RMv?v%ouP$,0^3W?q ~|1u\`rdrj< <upMK#v{:2dZW2XQ9_<'C_=; J T8C+\4Hv2\%C(v|hr+o=2H,-9#v4f%<h m "libpthread.so.0pthread_attr_initrecvconnectpthread_createrecvfromsendnanosleep__errno_location_Jv_RegisterClassespthread_attr_setdetachstatelibm.so.6__gmon_start__libc.so.6strcpystdoutvsprintfstrerroratolgetenvsemgetgetpidfgetsshmatmemcpyperrorfeofmallocvsnprintfsocketfflushputenvgmtime_rstrrchratoffprintfstrcatbindshmdtsetsockoptshmgetstdinmktimestrncpystrcasecmpsscanfstrdupgettimeofdayasctime_rmemsetntohsinet_ntoastrcmpgethostbynamefclosedifftimestderrshmctltimegmlocaltime_rfwritehtonssemctlsemopexitfopenatoi_IO_stdin_used__libc_start_mainstrchrfputstzsetsched_yieldfreeGLIBC_2.2GLIBC_2.1GLIBC_2.0@ii ii ii ii ii (bM`rdrhrA8b$c?(c@,cB0cC4cD8cFD$ D$2D$$0E D$ED$$Y24_U$r(pE}u E;Eu EEEU$r`U(fEErErEEE}t}trEArE5D$ D$2D$$0$t2} ~ri@+hD$T$ $Crhht E3D$?7E$hht r@EEE[Uht&hhr9t h$7hr~ArHrrih@+D$T$ $r@EEEU帔hU$hkUhEhEUE}uhE7E$E}uE<0thEEEEUhhEEu EEEEE8tEEUE}uhE7E$ E}uE<0thEEEEUW$ED$$h EE}Hhht(hHh< uhHhhƀhhuhh hhhhEE2Eh< u Eƀh Eh< tE@EEh;EċEhEƀhD$h$lh$_UW$hEht:ED$D$$h`uE$t E hE}Hhht(hHh< uhHhhƀhhuhh hhhhEE2Eh< u Eƀh Eh< tE@EEh;EċEhEƀhD$h$lhEE$_U帔lUEhEEE}tj}}tEh< Eh< Eh<"uEE@hEEhnEh< tEh< uREƀhE@hhhEEh<"u"EƀhE@hhhEOEh;E }u%hƀhhhhhEhEEU(E}uh]E$]E]EÐU(ptpE/E sPED$$tEs9E|ǡs9Eu&drED$D$7$EEЋ sEEUpt6pE;EЋ s;EuE sEEs9E|EEU(E$7SE}u1drD$ D$@D$$7eEEuVdrD$ D$2D$$7*drD$ D$D$$'8EptpED$E$oyKdrD$ D$2D$$7drED$D$D8$9EEEU$7"U(ptspE,E@PED$$tE s9E|ʡ s9Eu+drUT$D$`8$E EE@E EEUEEptpE4E@:EuE@@EE s9E|EEU(ptFpE,E@vPED$$itEs9E|ʡs9Eu+drUT$D$8$`E EE@vE EEUEEptpE4E@v:EuE@v@EEs9E|EEU(ptpE,E@PED$$$N$蒺EԹE}H v9drD$ D$ @EԉD$D$`>$$9EEE@;Eu0E@PEԉD$$htgE^E@PEԉD$$8u$E@;EtEE s9EW}drD$@D$:$E@ȋE@@drL$ D$D$>$drED$ EԉD$D$>$蜶 s9EuL s@PEԉD$$ sEЈ@ s@ sE'drD$ @EЉD$D$?$:;t1drD$ @EЉD$D$P?$$/W5KE؋E;EEp;EEEEDuEEE;E|}pdrD$ D$D$$?蝸Eu%drD$ D$D$$?pEu%drD$ D$ D$$?CEu%drD$ D$ D$$?Eu%drD$ D$D$$?drD$ D$D$$?ķE)EpdrD$D$?$GEp;EȡdrD$ D$ D$$?^$RĄ_ÐU@@@UE$跳UE$贳U(EEyEU);E}EU)ȉEMEU ED$ L$T$E$E}y#ED$D$@$@EEUEE;E{MMEU聳Ur‹EUD$E$EEUMEMbE)ÐUE D$E$E UW$ @色E}tAEddH|v$$@βDžhED$D$`@t$RKTZ=GfKMTK$KLt$h@lDžhNE$ŲEtD$$K<$Kt $@ ۲EhhĤ_UE D$E$E UWDE؉D$E$]E}uEESE ED$E؉D$E $ EعEĸ}ЍPE9r EE HE EȋEȃD_UWTE؉D$E$E}uEE]E ED$E؉D$E $至EعE}ЍPE9r EE H}uEE}ȉ}ċEăT_UEEED$E$$EP$d$EP$d$@EEUWVSEEE E} EE}E fEm]mEEEP$d$EA Am]mED$E$UM]ċuȋE̍xElEED$ T$L$\$t$|$ ED$D$@E$REEEČ[^_UWVSEEE E} EE(A]E}E fEm]mEEEP$d$E0Am]mED$E$UM]ċuȋE̍xElEED$ T$L$\$t$|$ ED$D$@E$bEEEČ[^_ÐUE$--#iȠE@ )ЍE@U(ME` E )ȉEE)Љ)‹E)ЉEE-#E D$E$ ME쉈E )‹E P E @ )щʋE)щʋE PE USEEE}EEmMEQE)ȉEEiб:EEЍE)MEQE)ȉEEiЬEEЍE)UEEiеEEE)EimEEEuE EEQE)É]kEd)‰U}uEEEQE)É]iE)‰U}uE E@EH qE@EBEE[US}tAlEȸ}H¡l\$D$C$lEĸ}HE+ElE‹ED$ E D$L$$訝E조+E;Eqt4EE `D$T$ D$ D$C $Ehu&UE E PEPE@EPEP E@D$D$E$zE}uED$$H%D$ D$D$E$軒E}uED$$H%UEUEBUEB UEBUxD$E$&$%E$ȐE}uE@D$$H%E@ D$ D$D$$E}uE@D$$H$EPED$D$$אE}uE@D$$I$U8D$D$E $eE}uE D$$I^$D$ D$E$ΑE}uE D$$9I'$EEE$蟏E}uE D$$UI#ED$D$E $ɎE}uE D$$qI#D$ D$E$2E}uE D$$I#D$D$E $E}uE D$$IT#UEUEBUEB UE BUE$觎E}uE@D$$I"UWVprft~EYEǀEƀEƀEƀEƀEǀE}~frEE؋E؃E܍EEEEEP E؋@9v3E@`rD$ ED$D$I$0EmfEfEfEEP D$EʉD$$襎Eԃ}uE@D$$J!EgEPE9uLE E8u5E PE8uE PE8uE9E|=u1`rD$ D$7D$$,J{EhEЋMЋEPEЉU fB@EoEEEЉfEEƋMЉEǍPE؋PEP E؋@ 9$E؋PE؋@EкuE؉PE؋P E؋@EкuE؉P E؋PE؋@ 9E؋PE؋@‹E؉PE؋P E؋@EкuЉEEE EW_INSTALLATIONGetLocalInst: Environment variable EW_INSTALLATION not defined. GetLocalInst: Environment variable EW_INSTALLATION defined, but has no value. has invalid value <%s> GetInst: Invalid installation name <%s> GetModId: Invalid module name <%s> GetType: Invalid message-type name <%s> EW_PARAMSGetUtil_LoadTable: Environment variable EW_PARAMS not defined! exiting!GetUtil_LoadTable: Environment variable EW_PARAMS defined, but has no value; exiting!GetUtil_LoadTable: length of EW_PARAMS+TableFile[%d] exceeds FullTablePath, MAXLEN=%d; exiting! GetUtil_LoadTable: Error opening file <%s>; exiting! RingGetUtil_LoadTable: Too many lines in <%s>; max=%d; exiting! GetUtil_LoadTable: Ring name <%s> too long in <%s>; max=%d chars; exiting! GetUtil_LoadTable: conflict in <%s>, new setting ignored original: new: ModuleGetUtil_LoadTable: Too many lines in <%s>GetUtil_LoadTable: Invalid module id <%d> in <%s> (0-255 are valid); exiting! GetUtil_LoadTable: Module name <%s> too long in <%s>; max=%d chars; exiting! original: new: MessageGetUtil_LoadTable: Too many lines in <%s>GetUtil_LoadTable: Invalid message type <%d> in <%s>GetUtil_LoadTable: Message name <%s> too long in <%s>; max=%d chars; exiting! original: new: InstallationGetUtil_LoadTable: Too many lines in <%s>; max=%d; exiting! GetUtil_LoadTable: Invalid installation id <%d> in <%s> (0-255 are valid); exiting! GetUtil_LoadTable: Installation name <%s> too long in <%s>; max=%d chars; exiting! original: new: GetUtil_LoadTable: <%s> Unknown command in <%s>. GetUtil_LoadTable: Bad <%s> line in <%s>; exiting! GetUtil_LoadTable: ERROR, no line(s) in file(s) <%s> exiting! ??MLMwMbMsMwpMdmblgsend error %d tTZtimegm_ew: unable to store current TZ environment variable.TZ=%stimegm_ew: putenv: unable to set TZ environment variable.timegm_ew: putenv: unable to restore TZ environment variable..A%04d/%02d/%02d %02d:%02d:%02d.%02d{Gzt?Y@{Gzt?Y@JanFebMarAprMayJunJulAugSepOctNovDec%04d%3s%2d %4d%6.2fN@NN@N@N%04d%02d%02d%02d%02d%05.2fN@N%04d%02d%02d%02d%02d%06.3fN@N%4d%2d%2d%2d%2d%2d.%2dN@Y@%4d%2d%2d%2d%2d%2d.%3dN@@@BB%04d%02d%02d%02d%02d%02d.00%4d%2d%2d%2d%2d%5lf%04d%02d%02d%02d%02d%02d.%02dY@??MLMwMbMsMwpMdmblgWARNING: Call logit_init before logit. %4d%02d%02dUTC date changed; log output continues in file <%s%s%s> aError opening log file <%s>. Exiting UTC date changed; log output continues from file <%s%s%s> %s_UTC_%02d:%02d:%02d (%d) logit(%s): ERROR!!! Attempting to log too large of a message!!! Logit buffer is %d bytes, message is %d bytes! logit(%s): ERROR!!! Attempting to log too large of a message!!! Logit buffer is %d bytes, message is more! %s%s%cCall to get_prog_name failed. %s logit_init: malloc error for %d bytes. Exiting EW_LOGEnvironment variable EW_LOG not defined; %s exiting. %s_%04d%02d%02d%s: Error opening log file <%s>. Exiting ------------------------------------------------------- %s: startup at UTC_%s_%02d:%02d:%02d This program is using the non-MT-Safe version of logit. ------------------------------------------------------- get_prog_name2() Null Pointer passed in. szFullName(%u), szProgName(%u). get_prog_name() Null Pointer passed in. full_name(%u), prog_name(%u).



WARNING: Call logit_init before logit.html_logit(%s): ERROR!!! Attempting to log too large of a message!!! Logit buffer is %d bytes, message is %d bytes! html_logit(%s): ERROR!!! Attempting to log too large of a message!!! Logit buffer is %d bytes, message is more! ERROR: %s

??MLMwMbMsMwpMdmblgtport_create shmctltport_create shmgettport_create shmattport_create semgettport_create semctltport_destroy shmdttport_destroy semctltport_destroy shmctltport_attach shmget ->headertport_attach shmat ->headertport_attach shmdt ->headertport_attach shmget ->regiontport_attach shmat ->regiontport_attach semgettport_detach shmdtERROR: tport_putmsg; message too large (%ld) for Region %ld tport_putmsg semop ->inuseERROR: tport_putmsg; exceeded NTRACK_PUT, msg not sent ERROR: tport_putmsg; keyold not at FIRST_BYTE, Region %ld tport_putmsg semop ->freeERROR: tport_getmsg; keyget not at FIRST_BYTE, Region %ld ERROR: tport_getmsg; exceeded NTRACK_GET tport_bufthr: Missed msg(s) c%d m%d t%d Overwritten, region:%ld.tport_bufthr: Missed msg(s) c%d m%d t%d Sequence gap, region:%ld.tport_bufthr: Logo c%d m%d t%d not tracked; NTRACK_GET exceeded.tport_bufthr: msg[%ld] c%d m%d t%d seq%d too big; skipped in region:%ld.tport_bufthr: msg[%ld] (c%d m%d t%d) too big for Region:%ld.&ibitport_buffer: Error allocating message buffer TYPE_ERRORtport_buffer: Invalid message type tport_buffer: pthread_attr_init error: %s tport_buffer: pthread_attr_setdetachstate error: %s tport_buffer: pthread_create error: %s ERROR: tport_copyfrom; keyget not at FIRST_BYTE, Region %ld ERROR: tport_copyfrom; exceeded NTRACK_GET ERROR: tport_copyto; message too large (%ld) for Region %ld tport_copyto semop ->inuseERROR: tport_copyto; keyold not at FIRST_BYTE, Region %ld tport_copyto semop ->free%ld %hd %s tport_bufthr: Error sending error:%hd for module:%d. ERROR: %s (%d; %s) Region: %ld ) Region: %ld sleep_ew: error from nanosleep: %s time requested = %.3f sec, time left = %.3f sec & .>s4i4s2i2WaveMsg2MakeLocal: packet from %s.%s.%s.%s has inconsistent header values! eWaveMsg2MakeLocal: header.starttime : %.4lf WaveMsg2MakeLocal: header.samplerate : %.1lf WaveMsg2MakeLocal: header.nsample : %d WaveMsg2MakeLocal: header.endtime : %.4lf WaveMsg2MakeLocal: computed.endtime : %.4lf WaveMsg2MakeLocal: header.endtime is not within 5 sample intervals of computed.endtime! @  -H  ,b@dD oԋoo4PaҎ"2BRbrҏ"2BRbrҐ"2BRbr‘ґ"2BRbr’Ғ"2BHa$Id: config.c,v 1.3 2006/09/06 21:37:21 paulf Exp $0-3-6-9-<-?-C-3-F-6-6-$Id: dispatch.c,v 1.4 2006/09/06 21:37:21 paulf Exp $t/w/z/}////w//z/z/$Id: ewc.c,v 1.4 2006/09/06 21:37:21 paulf Exp $\0_0b0e0h0k0o0_0r0b0b0$Id: gcf.c,v 1.4 2006/09/06 21:37:21 paulf Exp $333 3 3333333$Id: gputil.c,v 1.4 2006/05/16 17:14:35 paulf Exp $33333333333$Id: main.c,v 1.7 2007/02/19 22:07:38 stefan Exp $33333333333$Id: mainloop.c,v 1.2 2006/05/16 17:14:35 paulf Exp $ 44444444"444$Id: map.c,v 1.3 2006/05/16 17:14:35 paulf Exp $P4S4V4Y4\4_4c4S4f4V4V4$Id: scream.c,v 1.3 2006/05/16 17:14:35 paulf Exp $5 555555 5555$Id: util.c,v 1.2 2006/05/16 17:14:35 paulf Exp $66666676766VirginVirginD7G7J7M7P7S7W7G7Z7J7J7_7r7?????@@? @??;Zx0N<[y1O8Ahjulsec17Olc17N#gPPjsecsQhnargRpiRtisecSLhsecSHYjulsec18rc18q#gsPjsecsthnargupiutisecvLthsecvHepochsec17sectstr#jsecp epochsec18Jsectstr#jsecpYtimegm<J tmYtstr_VdsecHJo) ew_Date17_to_tH szDate17#stmJdTimeOuthdSecsg ew_t_to_Date17#t dTimeszBuffer#stmJdHSecs`tTime<w  mo_g  q #  cmoa q IGNU C 4.0.2 20051125 (Red Hat 4.0.2-8)logit.c/home/paulf/earthworm/src/libsrc/utilsize_t|unsigned charshort unsigned intlong unsigned intsigned charshort intintlong long intlong long unsigned int__quad_t;__off_t,long int__off64_t __time_t,hcharFILE.|q._flags #_IO_read_ptrb#_IO_read_endb#_IO_read_baseb# _IO_write_baseb#_IO_write_ptrb#_IO_write_endb#_IO_buf_baseb#_IO_buf_endb# _IO_save_baseb#$_IO_backup_baseb#(_IO_save_endb#,_markerso#0_chain u#4_fileno"#8_flags2&#<_old_offset(#@_cur_column,#D_vtable_offset-#F_shortbuf.{#G_lock2#H_offset;8#L__pad1D`#T__pad2E`#X__pad3F`#\__pad4G`#`__pad5Hn#d_modeJ#h_unused2L#l h__gnuc_va_list+h _IO_lock_t o_IO_marker  _nexto# _sbufu# _pos#,| hI hI'time_tLPva_listi tm, tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# tm_gmtoff,#$ tm_zone#(Klogit_core flagbbapflblstoutTsterrX\z`retcodedchxaddslashd sblogit_initd progbmidbufSizelogflag strbpprogName hI1_logitB$ flagbbaptget_prog_name2B&P szFullNamebszProgNamebiProgNameBufferLenstrbpstr1btTget_prog_name&| full_namebprog_namebstrbt html_logit flagbbapXflbp\z`retcode dc"hdone n  bI MagNames qfp8 `p N hI date> tdate_prev> ~now hIlogName  hIlogpath  hI?template    hI extension `bufblresinitddiskqsoeqpidlogbuffersizebErrorIssuedToStderrhstderruO '&GNU C 4.0.2 20051125 (Red Hat 4.0.2-8)transport.c/home/paulf/earthworm/src/libsrc/unixsize_tրunsigned charshort unsigned intlong unsigned intsigned charshort intintlong long intlong long unsigned int__quad_t;__uid_t__gid_t__off_tNlong int__off64_t__pid_t__time_tN__key_tchar+ ._flags #_IO_read_ptr #_IO_read_end #_IO_read_base # _IO_write_base #_IO_write_ptr #_IO_write_end #_IO_buf_base #_IO_buf_end # _IO_save_base #$_IO_backup_base #(_IO_save_end #,_markers #0_chain #4_fileno "#8_flags2 &#<_old_offset (?#@_cur_column ,#D_vtable_offset -#F_shortbuf .#G_lock 2#H_offset ;Z#L__pad1 D#T__pad2 E#X__pad3 F#\__pad4 G#`__pad5 Hr#d_mode J#h_unused2 L#l _IO_lock_t _IO_marker _next # _sbuf # _pos #?  z1  z'time_t Lpthread_t 2$ 9__size 7__align 8N  z#pthread_attr_t 9 ipc_perm$, __key-# uid.!# gid/0# cuid0!# cgid10# mode2# __pad13# __seq4# __pad25#6#7# shmatt_t/ shmid_dsT3 shm_perm4$# shm_segsz5r#$ shm_atime6#(8#, shm_dtime:#0<#4 shm_ctime>#8@#< shm_cpidBk#@ shm_lpidCk#D shm_nattchD#HE#L __unused5F#P semid_ds@( sem_perm)$# sem_otime*#$+#( sem_ctime,#,-#0 sem_nsems.#4/#80#< sembuf+ sem_num,# sem_op-# sem_flg.#:5N# keymax6# keyin7#8# flag9#SHM_HEAD:nM addr>n# key?N# midBN# sidCN# SHM_INFOM,T typeQ# modR# instidS#MSG_LOGOT \ startX# sizeYN#Z# seq[# TPORT_HEAD\v e`N#a# seqb# keyoutc# actived# MSG_TRACKe!  semunvalbuf array q tport_create`"  ]q ^N_Nshmandregidhsemidlsemargw pshmbufrestt  tport_destroy"  q respshmbufsemargw tq tport_attachb,   q NshmndNhregid!lsemid"pres#t tport_detachbbX  aq resrt tport_putmsg  q putlogo Nmsg trak+ nlogoitHsopsBresLshmnPringTirNXN\N`hd hdold ohjlbuild_header + v z Btport_getmsgHa  Aq B ngetCD  EBmsgFmaxsizeGNtrakIHnlogoJ`itKshmLnringMtmphdNYirON@PNDQNHhdR hSLihTPkeyinUTVXkeygetW\statusX`trakkedYdiZhjZlfindkey nextmsgb trackit>wrapupURN Yv z tport_putflagoaz  mq flagnshmpnttport_getflagz  }q shmnttport_bufthrC4 dummyerrnote~~msgsizeN~msgseq~res1`res2dgotmsgh  ztport_bufferC#` region1q region2q  ngetDmaxMsgSizemodule@instiderrortthrpattr Ltport_copyfrom\#   Tq U ngetVW  XBmsgYmaxsizeZNseq[+trak]H nlogo^ it_shm`nringatmphdbYircNdN@eNDhdf hgHihhLkeyiniPjTkeygetkXstatusl\lappedm`trakkedodiphjplfindkeynextmsg:trackitBaGwrapupytport_copyto $  q putlogo Nmsg seqsopsFresLshmnPringTirNXN\N`hd hdold ohjlytport_buferror&$% ierr$}note%'mmsg(y}size)Npt*}  ztport_syserrC%'& msgAkeyBNPut_Init'rGet_Init(rCopyfrom_Init)r " z MagNames  rMyModuleId: + stdout  stderr !PubRegion4PLt!BufRegion5XL!Getlogo6HL!Nget7TL!MaxMsgSize8LL!Message9DL!MyInstid;AL!TypeError<@Lv C'(&GNU C 4.0.2 20051125 (Red Hat 4.0.2-8)sleep_ew.c/home/paulf/earthworm/src/libsrc/unixsize_t&unsigned charshort unsigned intlong unsigned intsigned charshort intintlong long intlong long unsigned int__quad_t;__off_t/long int__off64_t&__time_t/kchartimespecwtv_secxS#tv_nsecy/# #3. _flags # _IO_read_ptre# _IO_read_ende# _IO_read_basee# _IO_write_basee# _IO_write_ptre# _IO_write_ende# _IO_buf_basee# _IO_buf_ende# _IO_save_basee#$ _IO_backup_basee#( _IO_save_ende#, _markerst#0 _chain z#4 _fileno"#8 _flags2&#< _old_offset( #@ _cur_column,#D _vtable_offset-#F _shortbuf.#G _lock2#H _offset;;#L __pad1Dc#T __pad2Ec#X __pad3Fc#\ __pad4Gc#` __pad5Hq#d _modeJ#h _unused2L#l _IO_lock_tt_IO_marker _nextt#_sbufz#_pos#1 k L# k L'sleep_ew,(&C'< alarmtime+sleeptime-sltimeleft.sderr/tstderrz\ o,D'GNU C 4.0.2 20051125 (Red Hat 4.0.2-8)swap.c/home/paulf/earthworm/src/libsrc/utilM @TpinnoH #nsampI #ZJ'#<L'#DM'#staN1# netOP#'chanPP#0dQ`#9qualityRp#<padSp#>intdoubleAHAMchar`HApHAHA TRACE_HEADERTt`@~pinnop #nsampq #Zr'#<t'#Du'#stav1# netwP#'chanx`#0locy`#4versionzp#7d{`#9quality|p#<pad}p#>pHA TRACE2_HEADER~ SwapShortID'y'h dataH tempJHw NcMp datNushort int RSwapIntYy'' dataXR tempZHw C^c]` dat^1s  SwapLongm'( datal tempnHw rcq` datrslong int &SwapDouble(( data& tempHw c, dato'<HAwWaveMsgMakeLocal (( wvmsgwzWaveMsg2MakeLocal (),D wvmsgz dataSize D byteOrderHK longPtrL shortPtrP i T nsamp @D'Z'<' tShouldEnd'X dFudgeFactor'`pSwapFloatC),o,pdataBtempDHwHcG`datHsfloat% : ; I$ > $ >   I : ;  : ;I8 : ;  : ; : ; I8 I !I/  : ; !I/.? : ; ' I@: ; I .? : ; ' I@.? : ; ' @4: ; I .? : ;' I@.? : ;' I@4: ;I 4: ; I? < 4: ; I?  % : ; I$ > $ >   I : ;  : ;I8 : ;  : ; : ; I8 I !I/  : ; .? : ; ' I@: ; I 4: ; I .? : ; ' I@.? : ;' I@: ;I 4: ;I .? : ;' @4: ; I? < % $ > $ > : ; I I&I : ;  : ; I8 .? : ; ' @ .? : ; ' @ : ; I .? : ; ' I@ 4: ; I .? : ; I@.? : ; I@I!I/ 4: ; I?  % $ > $ > : ; I I&I : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I 4: ; I 4: ; I?  % $ > $ > : ; I I&I : ;  : ; I8 : ; I8 .? : ; ' I@ : ; I 4: ; I : ; .? : ; ' @4: ; I .? : ;' I@: ;I 4: ;I .? : ;' @4: ;I I!I/ 4: ; I?  % : ; I$ > $ >   I : ;  : ;I8 &I : ;  : ; : ; I8 I!I/ .? : ; ' I@: ; I : ; I 4: ; I 4: ; I .? : ;' @: ;I 4: ;I : ;I .? : ;' I@4: ;I  : ;4: ; I? < % : ; I$ > $ >   I : ;  : ;I8 : ;  : ; : ; I8 I !I/  : ;  : ; I5I : ; I8  : ;  : ; .? : ; ' @: ; I 4: ; I .? : ;' @: ;I 4: ;I 4: ;I .? : ;' I@: ;I  : ; : ;!I/ 4: ; I? < !4: ; I?  % : ; I$ > $ >   I : ;  : ; I8  : ; : ;I8 : ; I !I/ .? : ; ' @: ; I 4: ; I 4: ; I? < % $ >  : ;  : ; I8  : ; I8 $ > I!I/ : ; I .? : ; ' @ : ; I 4: ; I  : ;  : ; I I.? : ; ' I@4: ; I .? : ;' @: ;I 4: ;I  : ; : ;Ii /usr/local/include/usr/local/include/bits/usr/lib/gcc/x86_64-redhat-linux/4.0.2/includekom.cstdio.hlibio.htypes.hstddef.hr,4rhdƝ61:V1d1f:1gd𜏎1f,:Q1gd𜏎1t,drsrԜm瀜:ViwdrsrԜm瀜:i:V1gr$r-r-Ԝh+d㜜1gdsԎ /usr/lib/gcc/x86_64-redhat-linux/4.0.2/include/home/paulf//earthworm/include/usr/local/include/usr/local/include/bitsgetutil.cstddef.hearthworm_defs.hstdio.hlibio.htypes.h,fV* +fV6+fge%%%VW% +d +fV'dr +V/ +fV'dr +V/ +fV'dr +V/ +reJ,:,6duYלr <-r1-*y+ +J$(<$%-r.-'y+ +F$%<$%-r.-'y+ +F$%<%%-r.-'y+ +F$%j%0%}}^qr'%----%A%  /home/paulf//earthworm/include/usr/local/include/bits/usr/local/include/sys/usr/local/includesocket_ew.csocket_ew.htime.htypes.hearthworm_defs.htypes.htimes.htime.h0:2d2d+hrs-(ew 2dr1d/gV:.d# /usr/local/include/usr/local/include/bits/usr/local/include/systime_ew.ctime.htypes.htime.htime.hd: +e&VWd: +qd$kqd$crr%V +x!)! R x!! R  /home/paulf//earthworm/include/usr/local/include/usr/local/include/bitschron3.cchron3.htime.htypes.hd61g%$':1wrVt,r,8;%:ix)ԂԀXe45Xr,8;z c1>iirrrru+:1 %$': +>= q>= qjSS@ +jSS@ +fIr +fIr +V vW&QsViwV,q:  /usr/lib/gcc/x86_64-redhat-linux/4.0.2/include/home/paulf//earthworm/include/usr/local/include/usr/local/include/bitslogit.cstdarg.hearthworm_defs.hstdio.hlibio.htypes.hstddef.htime.hrrrr q% -,,z ?8-:::;-9 ebeA  2 42)'=!dIdgd̎ r0c%UeYW& eYde%,?8::::9%%B%%ŝcfd+f#VdseVdseVde+g#IVde+r q U-,, ?8-:::;-9d ebeA  2 4(Wi)=#Ld͹? /home/paulf//earthworm/include/usr/local/include/bits/usr/lib/gcc/x86_64-redhat-linux/4.0.2/include/usr/local/include/sys/usr/local/includetransport.ctransport.hsem.hipc.htypes.hshm.hstddef.hsem.hpthreadtypes.htime.hearthworm_defs.hstdio.hlibio.h)#d0d/d/d1&d/3 c,d])dYdW +cd-d.d/d-d-d/2cdW +y Ӓdg' ddddZVdrrzU %:ԮHd (W乏nqG(e,IdeK,IOddXqwgx ӒrVry+ +e:(mz +-?2/^,+ U<dn乺rXdeH/dYVHHIItU+%W:ƭdIr+gvz+; qf +fd2  `;H_u(LVWLVW@WWdWw?VZU %r%:%%+% Z+rxgx ӒrVry+ +e:(msz+w-?2]-+ Uudn乺rXdeH/drYVHHIItU+%W:ƭdIr+dvz+;qӀdg'Hdydddd[ (W乏nqG(e,IdeK,IOddXy?2',%  c(4  /usr/local/include/usr/local/include/bits/usr/lib/gcc/x86_64-redhat-linux/4.0.2/includesleep_ew.ctime.htypes.hstdio.hlibio.hstddef.h(&+h/W%s_H /home/paulf//earthworm/includeswap.ctrace_buf.hD'jrrr.jrrrrrr/jrrrrrr.jrrsrrsrrsrrr +d + r666<g,,-+<;fV`HMjrrrrrr| AB D*AB  AB AB AB cAB SLAB cAB 'AB D)gAB D AB RAB >AB | X,AB XxAB XQ7AB XAB XAB XRwAB XAB XwAB XAB XwAB X#AB G| xAB xAB xAB xAB xAB xAB x!AB x+AB | LAB LAB GL9AB LVAB DLAB DLrRAB LAB ILAB I| <>AB <AB <AB D<QVAB D<AB D<QdAB <AB <AB E<NAB E<AB <AB <UAB <UAB <JAB F<AB D<AB I| EAB F_AB DdAB D'AB BAB &AB AB F| AB "AB lAB b4AB iAB Eb AB EaAB zAB AB ICAB # AB E AB E$AB G%AB | d(&AB | D'5AB y'FAB 'FAB (|AB (AB (AB I),FAB unsigned int_IO_FILE_IO_FILEunsigned intunsigned intunsigned intepochsecunsigned intminutebasebufferlen_IO_FILEpid_stampformatunsigned inttime_stampnbytesmemkeylength_IO_FILEsequencenwraplogo__unused1__unused2__unused3__unused4unsigned intregiongetlogonfillkeyoldunsigned int_IO_FILEendtimesamprateunsigned intstarttimedatatypettutt1u12t24t4;u;<t<>t>OuOPtPRtRlulmtmotouttutt~u~ttutt u  t tutthuhitiktkuttutt%u%&t&(t(\u\]t]_t_pupqtqsts&u&'t')t)uttSuSTtTVtVuttuttuttuttutt#u#$t$&t&6u67t79t9uttuttutt u !t!#t#Kuttut t 9u9:t:<t<VuVWtWYtYuttrurstsutuuttuttutt>u>?t?AtAuttuttut t uttuttuttuttJuJKtKMtM% u% & t& ( t( u  t  t U uU V tV X tX u t t ? u? @ t@ B tB . u. / t/ 1 t1  uttEuEFtFHtHutt[ u[ \ t\ ^ t^ u t t f uf g tg i ti  u  t  t uttuttrurstsutuuttutt{ u{ | t| ~ t~ uttutt u  t tuttuttW"uW"X"tX"Z"tZ"&u&&t&&t& 'u ''t''t''uttutt5u56t68t8{u{|t|~t~utt=u=>t>@t@PuPQtQStSutt+u.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc#(( 1HHP7 ?Go44 Toԋ pc DD l dd @ up{PP - (-($8Q8   rR Qd % _7 =O PLY   J T  + \ 4 Lr  # ,b9 I \LN v^ \o  C v hr , o  TL  V  _{ 2'